ZipRecruiter

Log In

1

Cinta Jobs (NOW HIRING)

Savard Personnel Group

Bilingual Shop Helper

Houston, TX · On-site

$14.25 - $18.25/hr

Capacidad para leer cinta métrica con precisión * Transporte confiable requerido * Operar y asistir con equipos del departamento de prensa * Uso de cinta métrica para mediciones precisas

Essential Staff

Be Seen First

Produccion de Queso

Fontana, CA · On-site

$16.90 - $17.15/hr

Posiciones disponibles para el 2ndo turno Trabajo en líneas de cinta transportadora inspeccionando queso, alimentando las líneas, empacando y paletizando los paquetes de queso. Subir y bajar ...

Tarter Gate Company, LLC

Operador de Maquina

Corinne, UT · On-site

$18/hr

... cinta, prensa plegadora, mesa de plasma, prensa minster, herrador, dobladora de tubos, entalladora de tubos, taladro de columna, puente grúa o montacargas. 2. Responsable del control de calidad.

Cantina La Veinte

Executive Chef

New York, NY · On-site

$140K/yr

... Cinta. Following massive success in Mexico City and Miami, we are bringing our sophisticated, vibrant, and authentic upscale dining experience to New York City. We are seeking a high volume, high ...

Fabuwood Cabinetry Corp

Asociado de almacén

Newark, NJ · On-site

$19 - $23/hr

Capacidad para leer una cinta métrica * Capacidad para trabajar en un entorno de equipo * Capacidad para leer / escribir Requerimientos físicos: * Puede ser necesario levantar con frecuencia hasta ...

Fabuwood Cabinetry Corp

Asociado de almacén

Newark, NJ · On-site

$19 - $23/hr

Capacidad para leer una cinta métrica * Capacidad para trabajar en un entorno de equipo * Capacidad para leer / escribir Requerimientos físicos: * Puede ser necesario levantar con frecuencia hasta ...

VOLT

Trabajador De Produccion

Fort Worth, TX · On-site

$14.75 - $17.75/hr

Conocimiento de herramientas manuales y cinta métrica. * Experiencia en un entorno de producción. * Capacidad para estar de pie durante 8 horas. * Capacidad para levantar hasta 40lb. Pago: $14.00 ...

Nexo Tecnico, Corp

PR

$14 - $18/hr

Herramientas propias bsicas (cinturn, martillo, cinta, etc. es un plus). * Buena condicin fsica (capaz de trabajar bajo el sol y cargar materiales). * Adems: Si no le tienes miedo a las alturas ...

Nexo Tecnico, Corp

PR

$14 - $18/hr

Herramientas propias bsicas (cinturn, martillo, cinta, etc. es un plus). * Buena condicin fsica (capaz de trabajar bajo el sol y cargar materiales). * Adems: Si no le tienes miedo a las alturas ...

Nexo Tecnico, Corp

PR

$14 - $18/hr

Herramientas propias bsicas (cinturn, martillo, cinta, etc. es un plus). * Buena condicin fsica (capaz de trabajar bajo el sol y cargar materiales). * Plus: Si no le tienes miedo a las alturas ...

Nexo Tecnico, Corp

PR

$14 - $18/hr

Herramientas propias bsicas (cinturn, martillo, cinta, etc. es un plus). * Buena condicin fsica (capaz de trabajar bajo el sol y cargar materiales). * Adems: Si no le tienes miedo a las alturas ...

New

Nexo Tecnico, Corp

PR

$14 - $18/hr

Herramientas propias bsicas (cinturn, martillo, cinta, etc. es un plus). * Buena condicin fsica (capaz de trabajar bajo el sol y cargar materiales). * Adems: Si no le tienes miedo a las alturas ...

next page

Showing results 1-20

People also search for

All JobsCinta Jobs

Cinta information

See salary details

$12

$20

$29

How much do cinta jobs pay per hour?

As of Jun 7, 2026, the average hourly pay for cinta in the United States is $20.93, according to ZipRecruiter salary data. Most workers in this role earn between $17.07 and $21.88 per hour, depending on experience, location, and employer.

What are Cinta jobs?

Cinta jobs typically refer to roles at Cinta, which is most commonly known as a beauty and wellness academy and salon. Employees at Cinta may work as cosmetologists, estheticians, instructors, or support staff, focusing on providing beauty services or education. These jobs involve working with clients, performing treatments, and maintaining a high standard of customer care. Cinta Academy is also known for training students in cosmetology, esthetics, and related fields.

What are the key skills and qualifications needed to thrive as a Cinta, and why are they important?

I'm sorry, but 'Cinta' is not recognized as a real-world professional occupation, so I cannot provide an answer for this job title.

What are some common challenges faced by a Cinta operator in a manufacturing facility?

As a Cinta operator, one common challenge is ensuring consistent machine performance while maintaining strict quality and safety standards. Operators must stay attentive to detect issues like material jams or irregularities in product output, which can disrupt workflow and cause delays. Additionally, adapting to varying production schedules and collaborating closely with maintenance and quality control teams is essential for smooth operations. Operators often need to troubleshoot equipment problems quickly to minimize downtime and maintain productivity.
More about Cinta jobs
What states have the most Cinta jobs? States with the most job openings for Cinta jobs include:
What job categories do people searching Cinta jobs look for? The top searched job categories for Cinta jobs are:
Cinta jobs near you
Infographic showing various Cinta job openings in the United States as of May 2026, with employment types broken down into 63% Full Time, 36% Part Time, and 1% Nights. Highlights an 100% Physical job distribution, with an average salary of $43,541 per year, or $20.9 per hour.
Harvest Room Labor PR09U, 1st shift, Team Lorenzo (LIVE HANG), Albertville, AL

Harvest Room Labor PR09U, 1st shift, Team Lorenzo (LIVE HANG), Albertville, AL

Tyson Foods

Albertville, AL • On-site

Full-time

Medical, Dental, Vision, Life, Retirement, PTO

Posted 3 days ago

Tyson Foods rating

6.5

Company rating: 6.5 out of 10

Tyson Foods

Based on 513 frontline employees who took The Breakroom Quiz

7.0

Company rating compared to similar companies: 7.0 out of 10

Food and drinks producers average

Based on 11,413 frontline employees who took The Breakroom Quiz

The best things about working at Tyson Foods

  • 93%

    93% say their health insurance is affordable

    say their health insurance is affordable

  • 81%

    81% say their managers don’t change their shifts at short notice

    say their managers don’t change their shifts at short notice

  • 81%

    81% say they get paid time off

    say they get paid time off

Featured by Tyson Foods, based on 513 Breakroom Quiz responses from their frontline employees

Job description

Job Details:

Job Title: Live Hanger(HarvestRoom Labor)

Job Description: Thisposition picks up live chickens from a conveyor belt and hangs them by the feet on a moving shackle line.

Job Synopsis: TheLive hanger picks up a chicken from a conveyor at waist height moving from theleft to rightand hangs the chicken by the feetina moving shacklelocatedover the conveyor belt at about chest height.DOA'srunoff the end of the beltontoDOAtable.Live hanger expectations are 24 birds per minuteinall positions except whenoperatingthe switch (28 birds per minute) Andany other duties as assigned by supervisor.

Descripcion del puesto:Este puesto recoge pollos vivos de una cinta transportadora ylos cuelgade las patas en una linea de ganchos moviles.

Sinopsis del puesto:El colgador de pollos vivos recoge un pollo de una cinta transportadora a la altura de la cintura, moviendose de izquierda a derecha, y lo cuelga de las patas en un gancho movil ubicado sobre la cinta transportadora aproximadamente a la altura del pecho. Los pollos muertos se deslizan por el extremo de la cinta hacia la mesa de pollos muertos. Las expectativas del colgador de pollos vivos son 24 aves por minuto en todas las posiciones, excepto cuando opera elinterruptor (28 aves por minuto) y cualquier otra tarea que le asigne el supervisor.

DeskripsyonJobla:Pozisyonsaresponsabpoupranpoulkitouvivan yosoubeltlaepikokepyeyonanliyShaklekappase a.

SaJobla mande:Mounkaptravaynandepatmansadweranmasepoultouvivan yosoubeltlakappasesotiadwatpoualeagochnannivosenti yoepikokepyeyonanShacklekapboujeanlebeltkappasekinannivolestomakmounkaptravayyo.Poulkivinitoumouriyoapale nanpwentbeltla pou aletonbeate.Aknenpotlotfonksyonkesipevizeameteou.

All applicants must provide their government identification number so the system can verify any previous Tyson employment history.This facility will not accept applicants that have worked for Tyson Foods 3or more timesThis facility accepts rehires after 180 days. Tyson reserves the right to require longer waiting periods or not accept rehires based on the reason for dismissal

Relocation Assistance Eligible:

No

Work Shift:

1ST SHIFT (United States of America)

Certain roles at Tyson require background checks. If you are offered a position that requires a background check you will be provided additional documentation to complete once an offer has been extended.

Hourly Applicants ONLY -You must complete the task after submitting your application to provide additional information to be considered for employment.

Tyson is an Equal Opportunity Employer. All qualified applicants will be considered without regard to race, national origin, color, religion, age, genetics, sex, sexual orientation, gender identity, disability or veteran status.

We provide our team members and their families with paid time off; 401(k) plans; affordable health, life, dental, vision and prescription drug benefits; and more.

If you would like to learn more about your data privacy rights and how you may use that information, please read our Job Applicant Privacy Notice here.

Unsolicited Assistance: Tyson Foods and its subsidiaries do not accept unsolicited support from external recruitment vendors for open positions within the United States. Any resumes or candidate profiles submitted by recruitment vendors or headhunters to any employee or applicant tracking system at Tyson Foods or its subsidiaries, without a valid written request and search agreement approved by HR, will be considered the property of Tyson Foods. No fees will be paid if the candidate is hired due to an unsolicited referral.

Working at Tyson Foods

Perks for frontline workers

From Tyson Foods, via Breakroom

  • Pay: Competitive Pay and Benefits

  • Benefits: Health, vision, and dental Insurance on day one of full-time employment

  • Education: Fully-funded education for all US-based Team Members!

  • Financial Benefits: 401(k) & Employee Stock Purchase Plan (ESPP)

  • Career Growth: Grow your career with an industry leader, and Fortune 100 company!

  • Safety: Committed to workplace safety!

  • Time Off: Generous paid time off / earned time off for Team Members

  • Work-Life Balance: Includes Employee Assistance Programs (EAP), paid parental leave, discount programs, adoption assistance, etc.

What to expect from working at Tyson Foods

From Tyson Foods

About Tyson Foods, in their own words

From Tyson Foods

Tyson Foods, Inc. (NYSE: TSN) is a world-class food company and recognized leader in protein. Founded in 1935 by John W. Tyson, it has grown under four generations of family leadership. The Company is unified by this purpose: Tyson Foods. We Feed the World Like Family™ and has a broad portfolio of iconic products and brands including Tyson®, Jimmy Dean®, Hillshire Farm®, Ball Park®, Wright®, State Fair®, Aidells® and ibp®. Tyson Foods is dedicated to bringing high-quality food to every table in the world, safely and affordably, now and for future generations. Headquartered in Springdale, Arkansas, the company had approximately 138,000 team members as of September 2024.

Company values

From Tyson Foods

We are a company of people engaged in the production of food, seeking to pursue truth and integrity, and committed to creating value for our shareholders, our customers, our team members, and our communities.

Who we are: We strive to be honorable and operate with integrity. We strive to be faith-friendly and inclusive. We strive to serve as stewards of the resources entrusted to us. We strive to provide a safe work environment.

What we do: We feed our families, the nation, and the world with trusted food products. We serve as stewards of the animals, land, and environment entrusted to us. We strive to provide a safe work environment for our team members.

How we do it: We strive to earn consistent and satisfactory profits for our shareholders and to invest in our people, products, and processes. We strive to operate with integrity and trust in all we do. We strive to honor God and be respectful of each other, our customers, and other stakeholders.

"From the beginning, our company has been built on faith, family, and hard work. That tradition, our Core Values, and 'doing what's right' are deeply embedded in our culture."

John Tyson, Chairman

What Tyson Foods employees say

Pay

Benefits

Hours and flexibility

Workplace

Get the full story on Breakroom

Apply